DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and T22A3.6

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_492773.3 Gene:T22A3.6 / 188711 WormBaseID:WBGene00011909 Length:491 Species:Caenorhabditis elegans


Alignment Length:117 Identity:19/117 - (16%)
Similarity:36/117 - (30%) Gaps:36/117 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 LADWLQCMDVQVISNGECARSYG--------SVASTDMCTRATDGKSVCG-------GDSGGALV 215
            :..|..|:.:..:.|....:|:.        :|:.:|.|....:.:.:.|       .|:|....
 Worm     2 MVSWKLCLILTGLVNVFLTKSFTRTFSQKFVNVSISDDCETTEESERIFGYRTNFYSDDTGNVFC 66

  Fly   216 THDNPIQVGVITFASIG---------CKSGPSGYTRVSDHLDWIREKSGIAY 258
            .....   |.|..:|..         |..|         .:||.|.|..:.:
 Worm    67 FRKKD---GSIRMSSTSRFFEDPRFMCSKG---------SMDWYRGKKNVDF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 18/110 (16%)
Tryp_SPc 35..250 CDD:214473 16/107 (15%)
T22A3.6NP_492773.3 KR 98..173 CDD:350900 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.