DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CTRL

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:237 Identity:71/237 - (29%)
Similarity:116/237 - (48%) Gaps:20/237 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPYAVGLRMNNG-AVGGGSVIGNNWVLTAAHCLTTDS----VTIHYGSNRAWNG 94
            ||||..|..|..|:.|.|:.::| ...|||:|..:||:|||||..:..    |...|  :|:.|.
Human    34 IVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEY--DRSSNA 96

  Fly    95 QLQHTVNKNNFFRHPGYPNSA-GHDIGLIR--TPYVSFTNLINKVSLPKFSQKGERFENWWCVAC 156
            :....::.:....||.:.::. .:|:.|::  :| ..:|..|:.|.|.  |......|...||..
Human    97 EPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASP-AQYTTRISPVCLA--SSNEALTEGLTCVTT 158

  Fly   157 GWGGMANGG--LADWLQCMDVQVISNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTH-- 217
            |||.::..|  ....||.:.:.:::..:|.:.:||..:..|......|.|.|.|||||.||..  
Human   159 GWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKG 223

  Fly   218 DNPIQVGVITFASIGCK-SGPSGYTRVSDHLDWIREKSGIAY 258
            :..:.:|::::.:..|. ..|:.|||||....||.:.  |||
Human   224 NTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQV--IAY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 68/230 (30%)
Tryp_SPc 35..250 CDD:214473 66/227 (29%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 68/230 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.