DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG43336

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:266 Identity:71/266 - (26%)
Similarity:116/266 - (43%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGLRMNNGA-VGGGSVIGNNWVLTAA 74
            |:...|..|     ||....|:  :.||..|....:|:...|...:|. :.|||:|.|..|||||
  Fly    21 FLDMACGIR-----AHSPSVPR--VKNGTVASLTSSPWMAFLHSTDGRFICGGSLITNRLVLTAA 78

  Fly    75 HC-LTTDSVTIHYGSNRAWNGQLQH----------TVNKNNFFRHPGY-PNSAGHDIGLIRTPY- 126
            || |....:....|.......::.|          .|.:.  |||..| |.:..:||.::|. | 
  Fly    79 HCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERG--FRHRHYNPMTMAYDIAILRL-YR 140

  Fly   127 -VSFTNLINKVSL---PKFSQKGERFENWWCVACGWGGMANGGLADWLQCMDVQVISNGECARSY 187
             |.:|:.|..:.:   |::.:..:..:.  ....|||...:.|.:..|:.:|: ...:.|..|.|
  Fly   141 KVQYTDNIRPICIVIDPRWRKYIDSLDP--LTGTGWGKTESEGDSAKLRTVDL-ARKHPEVCRRY 202

  Fly   188 G--SVASTDMCTRATDGKSVCGGDSG---GALVTHDNP---IQVGVITFASIGCKSGPSGYTRVS 244
            .  |:.:...|. ..:..::|.||||   |||:.:...   :|||:.:|.:..|.. .|.:|.|.
  Fly   203 ATLSLTANQFCA-GNERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVM-VSVFTDVM 265

  Fly   245 DHLDWI 250
            .::|||
  Fly   266 SYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 65/242 (27%)
Tryp_SPc 35..250 CDD:214473 63/240 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 63/243 (26%)
Tryp_SPc 40..271 CDD:238113 63/238 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435904
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.