DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG43124

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:229 Identity:46/229 - (20%)
Similarity:87/229 - (37%) Gaps:41/229 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VNGYPAYEGKAPYAVGLRMNNGAVGGGSVIGNNWVLTAAHCL-TTDSVTIHYGSNRAWNGQLQHT 99
            :||    ...||:...:..::..:..|::|.|.:|||||.|. ..:.:|:..||...........
  Fly    34 ING----SSYAPWLAEILSDSKVICAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFR 94

  Fly   100 VNKNNFF-RHPGYPNSAGHDIGLIR-TPYVSFTNLINKVSL---PKFSQKGERFENWWCVACGWG 159
            |.|..|: .|  :|.:..:::.:.| ...|.|...|..:.:   ||.......||          
  Fly    95 VTKAYFWMTH--FPANNTNNLCIFRLQTEVEFKTHIRPMCITKSPKSLGLATTFE---------- 147

  Fly   160 GMANGGLADWLQCMDVQVI----SNGECARSYGSVASTDMCTRATDGKSVCGGDSGGALVTHDNP 220
             :.|.....|..|.:::.:    ..||....:.|..:....|     :::..|...|.       
  Fly   148 -IINEKPKMWYFCKNIKGLFCKYVFGENEEKWQSKPTGSPWT-----ETISNGPFKGL------- 199

  Fly   221 IQVGVITFASIGCKSGPSGYTRVSDHLDWIREKS 254
            ::.|::::..  .|:....|..|..|::||.:.|
  Fly   200 VRYGILSYRD--NKTYDEVYINVMSHINWIAQIS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 45/226 (20%)
Tryp_SPc 35..250 CDD:214473 43/223 (19%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 22/93 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.