DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG43125

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:170 Identity:36/170 - (21%)
Similarity:63/170 - (37%) Gaps:63/170 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 APYAVGLR--MNNGAVGGGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFR- 107
            ||:.|.:|  :::.....|::|...:|||||.|:...:..|      ...|::..|:..::..: 
  Fly    36 APWLVKIRPELSSNITCTGTLINERFVLTAASCIDYQTELI------VRLGEIDGTLQNSSKLQY 94

  Fly   108 ----------HPGYPN-SAGHDIGLIR--TPYVSFTNL--------INKV-------------SL 138
                      |..|.: |..::|.|:|  |..|...|:        :.||             ..
  Fly    95 EEIYVARALIHRSYSSESHQYNIALLRLKTSVVYKKNIQPICIDVNVGKVPKAPTFEIEKKKNEE 159

  Fly   139 PKFSQKG--ERFENWWC------------------VACGW 158
            ||.::.|  :||.||:.                  :|.||
  Fly   160 PKKNKAGIMKRFLNWFLSLFGVREPRPDVILPPQPIAVGW 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 36/170 (21%)
Tryp_SPc 35..250 CDD:214473 36/170 (21%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 23/105 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.