DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and Cela1

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:279 Identity:83/279 - (29%)
Similarity:121/279 - (43%) Gaps:53/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLLLFVATV-CAHRNRNRTAHHGGGPKDI------IVNGYPAYEGKAPYAVGLRMNNGA---- 58
            ::..|:|.:.| |.|           ..:|:      :|.|..|.....|..:.|:...|.    
Mouse     1 MLRFLVFASLVLCGH-----------STEDVPETDARVVGGAEARRNSWPSQISLQYQYGGSWHH 54

  Fly    59 VGGGSVIGNNWVLTAAHCLTTD-SVTIHYGS-NRAWNGQLQHTVNKNNFFRHPGYPNS----AGH 117
            ..||::|.:|||:|||||:.:. :..:..|. |.:.|...:..||......|| |.|.    ||:
Mouse    55 TCGGTLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHP-YWNKNNVVAGY 118

  Fly   118 DIGLIRTPYVSFTNLINKVSLPKFSQKGERF-ENWWCVACGWG-GMANGGLADWLQCMDVQVISN 180
            ||.|:|  ......|.|.|.|....::|... .|..|...||| ...||.||..||...:..:|.
Mouse   119 DIALLR--LAKSVTLNNYVQLGVLPREGTILANNSPCYITGWGRTRTNGELAQTLQQAYLPSVSY 181

  Fly   181 GECARS--YG-SVASTDMCTRATDGKSVCGGDSGGAL--------VTHDNPIQVGVITF-ASIGC 233
            ..|:.|  :| ||.:|.:|......:|.|.|||||.|        ..|      ||.:| :|:||
Mouse   182 SICSSSSYWGSSVKNTMVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVH------GVTSFVSSMGC 240

  Fly   234 KSG--PSGYTRVSDHLDWI 250
            ...  |:.:||||.::.|:
Mouse   241 NVARKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 77/242 (32%)
Tryp_SPc 35..250 CDD:214473 76/240 (32%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 76/240 (32%)
Tryp_SPc 27..262 CDD:238113 77/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.