DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and PRSS21

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:288 Identity:81/288 - (28%)
Similarity:132/288 - (45%) Gaps:39/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLLFVATVCAHRNRNRTAHHGGGP------KDIIVNGYPAYEGKAPYAVGLRMNNGAVGGGSV 64
            :||.|.:|.....:..::.|....||      ...||.|..|..|:.|:...||:.:..|.|.|:
Human     7 LLLALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSL 71

  Fly    65 IGNNWVLTAAHCLTTDS-------VTIHYGSNRA----WNGQLQHT-VNKNNFFRHPGYPNSAGH 117
            :.:.|.||||||..|.|       ..:.:|...:    |:.|..:| ...:|.:..|.|..::.:
Human    72 LSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPY 136

  Fly   118 DIGLIR-TPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGL---ADWLQCMDVQVI 178
            ||.|:: :..|::|..|..:.|...:.:.|...:.|  ..|||.:.....   ...||.:.|.:|
Human   137 DIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCW--VTGWGYIKEDEALPSPHTLQEVQVAII 199

  Fly   179 SNGECAR-----SYGSVASTDM-CT-RATDGKSVCGGDSGGALVTHDNPI--QVGVITFASIGC- 233
            :|..|..     |:......|| |. .|..||..|.|||||.|..:.|.:  |:||::: .:|| 
Human   200 NNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSW-GVGCG 263

  Fly   234 -KSGPSGYTRVSDHLDWIRE---KSGIA 257
             .:.|..||.:|.|.:||::   :||::
Human   264 RPNRPGVYTNISHHFEWIQKLMAQSGMS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 72/247 (29%)
Tryp_SPc 35..250 CDD:214473 70/241 (29%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.