DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and CG42694

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:102/277 - (36%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLFVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGL-RMNNG--AVGGGSVIGNNWV 70
            ||.:..:.:|.|......:.|.|    ::.....:.:.|.|..| .::||  .:..||:|...:|
  Fly     8 LLMLTVLQSHVNSKFLDDYCGAP----ISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFV 68

  Fly    71 LTAAHCLTT-DSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIR----TPYVSF- 129
            |:||.|:.. ..:.:..|.:.|......:||:......|.|  .....||||::    ..|..| 
  Fly    69 LSAAQCIDVHGKLFVQLGVSNATKSPHWYTVSNVVIPSHSG--KRLQRDIGLLKLSQSVDYNDFV 131

  Fly   130 --------TNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGLADWL------QCMDVQVISN 180
                    ||.::.|.:                      :.|...:.||      |.:.:..:|.
  Fly   132 YPICIALNTNTLDMVKI----------------------LQNFTTSAWLSKNKNPQTIVLSQLSR 174

  Fly   181 GECARSY-GSVASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVG--VITFASIGCK-------- 234
            ..|..:. |:|...::|..:....:.|..|||.||.   .||..|  ::.....|.:        
  Fly   175 DRCKLNLSGNVTPKEICAASLQRNNSCFIDSGSALT---QPIIQGSNIVREMLFGIRGYVNGRSW 236

  Fly   235 -SGPSGYTRVSDHLDWI 250
             |.|:.|..|::.:.||
  Fly   237 CSEPAIYIDVAECVGWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 53/251 (21%)
Tryp_SPc 35..250 CDD:214473 51/249 (20%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 51/235 (22%)
Tryp_SPc 46..253 CDD:214473 49/233 (21%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435916
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.