DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and cela1.2

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:281 Identity:80/281 - (28%)
Similarity:126/281 - (44%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLLLLFVATVCAHRNRNRTAHHGGGPKDI-----IVNGYPAYEGKAPYAVGLRMNNGAVG----- 60
            :|||..:||:.....|..        |||     :|.|..|.....|:.:.|:.::  :|     
Zfish     4 ILLLSVLATLALAEPRYL--------KDIAIEERVVGGEIAKPHSWPWQISLQYSD--LGTYYYY 58

  Fly    61 -GGSVIGNNWVLTAAHCL-TTDSVTIHYGSNRAW--NGQLQHTVNKNNFFRHPGY-PNSA--GHD 118
             .|::|...||:.||||: .....|:..|.:..:  .|..|: ::.:..|.||.: ||:.  |:|
Zfish    59 CSGTLIRPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQY-ISVSEVFIHPNWNPNNVAFGYD 122

  Fly   119 IGLIRTPY-VSFTNLINKVSLPKFSQKGERFE-NWWCVACGWGGMANGG-LADWLQCMDVQVISN 180
            |.|:|... .:.::.:...:||   ..||... ...|...|||....|| |:..|:...:.|:..
Zfish   123 IALLRLSIDATLSSYVQVATLP---SSGEILPYGHTCYITGWGYTETGGSLSAQLKQAYMPVVDY 184

  Fly   181 GECARS--YG-SVASTDMCTRATDGKSVCGGDSG--------GALVTHDNPIQVGVITFAS-IGC 233
            ..|::.  :| ||..|.:|...|...|.|.||||        |..|.|      ||.:|.| .||
Zfish   185 ETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVH------GVTSFVSPEGC 243

  Fly   234 KS--GPSGYTRVSDHLDWIRE 252
            .:  .|:|:||||.:::||.:
Zfish   244 NTYKKPTGFTRVSAYINWINQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 71/247 (29%)
Tryp_SPc 35..250 CDD:214473 69/243 (28%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 69/244 (28%)
Tryp_SPc 30..265 CDD:238113 71/247 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.