DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8329 and zgc:163079

DIOPT Version :9

Sequence 1:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:250 Identity:75/250 - (30%)
Similarity:113/250 - (45%) Gaps:41/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVNGYPAYEGKAPY--AVGLRMNNGAVGGGSVIGNNWVLTAA--HCLTTDSVTIHYGSNRAWNG- 94
            |:.|..|.:|..|:  ::.|:.......|||:|...||||.|  ..|...|..:.|...:..|| 
Zfish    36 IIGGLNATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQTQNGS 100

  Fly    95 ---QLQHTVNKNNFFRHPGYPNSAGHDIGLIR--TPYVSFTNLINKVSLPKFSQKGERF----EN 150
               ::..||.|  ..:||.| ||...::.|::  :| |:|::.|..|.|   :..|..|    .:
Zfish   101 NPYEISRTVTK--IIKHPNY-NSLDSNLALLKLSSP-VTFSDYIKPVCL---AAAGSVFVDGTAS 158

  Fly   151 WWCVACGWGGMANGG------LADWLQCMDVQVISNGECARSYGSVASTDMCTRA---TDGKSVC 206
            |   ..|||.:....      |.|.||.::..:::|.||..:||.:.:..:....   .|||:.|
Zfish   159 W---VTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYGGIITNKLLCAGYLNEDGKAPC 220

  Fly   207 GGDSGGALVTHDNP--IQVGVITFASIGCKSGPSGYTRVSDHLDWIREKSGIAYY 259
            .||.||.||.....  ||.||:.....|....|:.|.|||::.||      |:||
Zfish   221 AGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDW------ISYY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 72/242 (30%)
Tryp_SPc 35..250 CDD:214473 71/239 (30%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 72/245 (29%)
Tryp_SPc 36..267 CDD:238113 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.