DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and PPIG

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_004783.2 Gene:PPIG / 9360 HGNCID:14650 Length:754 Species:Homo sapiens


Alignment Length:257 Identity:95/257 - (36%)
Similarity:136/257 - (52%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHK 73
            :|...|..:.||:|..:.|||::.||..||.|||.||||.|||||.|.| :..||||||...||:
Human     3 IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHR 67

  Fly    74 IKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGC 138
            :.:.|:||.||..:.:|..||||||..|:||:|.:.||:|.::||||.|| ::|.|||||:....
Human    68 VVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGK-DTNGSQFFITTKPT 131

  Fly   139 ENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI------------AHNEDWG 190
            .:|:|.:||.|:|:.|..:|.|:|...||... |.|.:.|..|||:            .|.....
Human   132 PHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPKSKVKKEEKKRHKSSSS 196

  Fly   191 IECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKYRKANR 252
            ...:...:|.    ..|.....|....:.|.|..:..|:..:.  :..|.|:...|.||.::
Human   197 SSSSSSDSDS----SSDSQSSSDSSDSESATEEKSKKRKKKHR--KNSRKHKKEKKKRKKSK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 79/167 (47%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PPIGNP_004783.2 cyclophilin 8..175 CDD:412213 79/167 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..754 12/77 (16%)
PTZ00121 <392..752 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.