DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and CPR2

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:68/168 - (40%)
Similarity:94/168 - (55%) Gaps:9/168 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81
            |:.||..|:|..||::|.|...|.||||:||..|.|      |......:.|:.||::...|:||
Yeast    38 VFFDIEHGEEKVGRIVIGLYGKVCPKTAKNFYKLST------TTNSKKGFIGSTFHRVIPNFMVQ 96

  Fly    82 SGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAA-GCENLNGTN 145
            .||.....|..|:||||..|.||||.|.|:.:|.:||||.|| ::|.|||||:.. ....|:|.:
Yeast    97 GGDFTDGTGVGGKSIYGDTFPDENFTLKHDRKGRLSMANRGK-DTNGSQFFITTTEEASWLDGKH 160

  Fly   146 VVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGE 182
            ||.|:|:.|:.:|..::....|..| |...:.|..|||
Yeast   161 VVFGQVVDGMDVVNYIQHVSRDANDKPLEAVKIAKCGE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 65/165 (39%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
CPR2NP_011924.1 cyclophilin 37..197 CDD:469651 65/165 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.