DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppig

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_113981.2 Gene:Ppig / 83624 RGDID:620315 Length:752 Species:Rattus norvegicus


Alignment Length:257 Identity:95/257 - (36%)
Similarity:136/257 - (52%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHK 73
            :|...|..:.||:|..:.|||::.||..||.|||.||||.|||||.|.| :..||||||...||:
  Rat     3 IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHR 67

  Fly    74 IKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGC 138
            :.:.|:||.||..:.:|..||||||..|:||:|.:.||:|.::||||.|| ::|.|||||:....
  Rat    68 VVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGK-DTNGSQFFITTKPT 131

  Fly   139 ENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIA------------HNEDWG 190
            .:|:|.:||.|:|:.|..:|.|:|...||... |.|.:.|..|||:.            |.....
  Rat   132 PHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELVPKSKVKKEEKKRHKSSSS 196

  Fly   191 IECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKYRKANR 252
            ...:|..:.      .|.....|....:.|.|..:..|:..:.  :..|.|:...|.||.::
  Rat   197 SSSSDSDSS------SDSQSSSDSSDSESASEEKSRKRKKKHR--KNSRKHKKEKKKRKKSK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 79/167 (47%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PpigNP_113981.2 cyclophilin 8..175 CDD:412213 79/167 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752 12/77 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339740
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.