DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and ROC1

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_195585.1 Gene:ROC1 / 830029 AraportID:AT4G38740 Length:172 Species:Arabidopsis thaliana


Alignment Length:170 Identity:85/170 - (50%)
Similarity:118/170 - (69%) Gaps:1/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFV 79
            |.||.|::|..:.|||:::||..|..|:||||||||||||.|:|..|||||:||:|||::...|:
plant     4 PKVYFDMTIDGQPAGRIVMELYTDKTPRTAENFRALCTGEKGVGGTGKPLHFKGSKFHRVIPNFM 68

  Fly    80 VQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGT 144
            .|.||....:|:.||||||..|:|||||..|...|::||||.| .|:|.|||||.....:.|:|.
plant    69 CQGGDFTAGNGTGGESIYGSKFEDENFERKHTGPGILSMANAG-ANTNGSQFFICTVKTDWLDGK 132

  Fly   145 NVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIA 184
            :||.|:|:.||.:|..:|:..:..|.||.|:|:.|||:::
plant   133 HVVFGQVVEGLDVVKAIEKVGSSSGKPTKPVVVADCGQLS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 83/165 (50%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
ROC1NP_195585.1 cyclophilin_ABH_like 4..169 CDD:238907 83/165 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.