DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and AT4G34960

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_195222.1 Gene:AT4G34960 / 829648 AraportID:AT4G34960 Length:224 Species:Arabidopsis thaliana


Alignment Length:192 Identity:92/192 - (47%)
Similarity:124/192 - (64%) Gaps:4/192 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EERKLLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHY 66
            ||::::...:.|| .|:||:.|..:..||::|.|...|||||.||||||||||.|..:.||||||
plant    35 EEKQVIEDHEITN-RVFLDVDIDGQRLGRIVIGLYGTVVPKTVENFRALCTGEKGKTSSGKPLHY 98

  Fly    67 KGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQF 131
            |||.||:|...||:|.||::..||.|.:||||..|.||||::.|:..|:|:|||.| |:||.|||
plant    99 KGTPFHRIISGFVIQGGDIIHGDGKSSDSIYGGTFPDENFKIQHSHAGMVAMANTG-PDSNGSQF 162

  Fly   132 FISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNC-TDEGDPTAPIVIRDCGEIAHNEDWGIE 192
            ||:......|.|.:||:|:|::|:..|..:|... |..|.|...:||.|.|||. .:.|..|
plant   163 FITTVKASWLEGEHVVLGKVIQGMDNVFAIEGGAGTYSGKPRKKVVIADSGEIP-KDKWDEE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 83/166 (50%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
AT4G34960NP_195222.1 cyclophilin 48..213 CDD:412213 83/165 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.