DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and ROC5

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_195213.1 Gene:ROC5 / 829639 AraportID:AT4G34870 Length:172 Species:Arabidopsis thaliana


Alignment Length:172 Identity:82/172 - (47%)
Similarity:113/172 - (65%) Gaps:1/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            :||.|:.|:|:.....||:.:||..|..|.||||||||||||.|:|.||||||:||:.||::...
plant     2 SNPRVFFDMSLSGTPIGRIEMELFADTTPNTAENFRALCTGEKGMGKLGKPLHFKGSIFHRVIPG 66

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLN 142
            |:.|.||....:|:.||||||..|.||||...|...|::||||.| ||:|.|||||.......|:
plant    67 FMCQGGDFTAKNGTGGESIYGAKFKDENFIKKHTGAGILSMANSG-PNTNGSQFFICTDKTSWLD 130

  Fly   143 GTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIA 184
            |.:||.|:|::||.:|..:|:..:|.|..:..:.|.|||:::
plant   131 GKHVVFGQVVKGLDVVKAIEKVGSDSGKTSKVVTITDCGQLS 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 79/165 (48%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
ROC5NP_195213.1 cyclophilin_ABH_like 4..169 CDD:238907 79/165 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.