DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and AT4G32420

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001190889.1 Gene:AT4G32420 / 829377 AraportID:AT4G32420 Length:837 Species:Arabidopsis thaliana


Alignment Length:249 Identity:88/249 - (35%)
Similarity:128/249 - (51%) Gaps:53/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHKI 74
            |..||.|::|:||..:.|..|:.||..:|.|||:||||||||||.||| ..||||||||:.||:|
plant     3 KKKNPQVFMDVSIDGDPAETMVFELFPEVAPKTSENFRALCTGEKGIGPRSGKPLHYKGSFFHRI 67

  Fly    75 KRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMA-----NYGKPNSNNSQFFIS 134
            .:....|:||.|..:|::|||||...|.||:.:|.|.|.|::||:     .:|      |.|.|:
plant    68 MKGSSAQAGDFVNRNGTAGESIYAGKFPDESPKLRHEETGLLSMSIADRDKFG------SHFHIT 126

  Fly   135 AAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETTD 199
            ....:.|:..|||.|::::|..|:.::|:...:||.||..:.|..|||.:.              
plant   127 FRPNQQLDRNNVVFGKLIQGKEILKKIERVGDEEGKPTVSVKIIRCGEYSG-------------- 177

  Fly   200 KLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKYRKANRY 253
                         ||...||        :::|.|...|      |.:.:|..|:
plant   178 -------------DKKKSDG--------KKNGKHKKSL------RVRRKKRRRH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 73/171 (43%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
AT4G32420NP_001190889.1 cyclophilin 7..173 CDD:381853 73/171 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.