DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and AT2G47320

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_182254.1 Gene:AT2G47320 / 819345 AraportID:AT2G47320 Length:230 Species:Arabidopsis thaliana


Alignment Length:166 Identity:50/166 - (30%)
Similarity:79/166 - (47%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQS 82
            :..:..||   |.:.|||.||..|...:.|...|          :..::||..|.::.:.||:|:
plant    79 FATLDTGK---GSVTIELFKDTAPNVVDQFMKFC----------QDGYFKGFLFSRVVKHFVIQA 130

  Fly    83 GDVVKNDGSSGESIYGPVFDDENFELS-HNEEGVVSMANYGKPNSNNSQ----FFISAAGCENLN 142
            ||..:.|     ::.....|.:|.:.| .:||.:|     |.|.:.|.|    |||.:|..::||
plant   131 GDSAEFD-----AVKDWALDRKNIDTSLKHEEFMV-----GTPKAKNEQGGFEFFIVSAQIKDLN 185

  Fly   143 GTNVVVGRVLRGLGIVAEMEQNCTDEG-DPTAPIVI 177
            ....|.|||.:|..:|.|:|:..||:. .|.:||.|
plant   186 EKLTVFGRVSKGQDVVQEIEEVETDDQYQPKSPIEI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 50/166 (30%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
AT2G47320NP_182254.1 cyclophilin 81..223 CDD:238194 50/164 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.