DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and ROC3

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001318231.1 Gene:ROC3 / 816161 AraportID:AT2G16600 Length:173 Species:Arabidopsis thaliana


Alignment Length:173 Identity:88/173 - (50%)
Similarity:119/173 - (68%) Gaps:1/173 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76
            :|||.||.|:::|.:.|||:::||..|..|:||||||||||||.|||..||||||||:.||::..
plant     2 ATNPKVYFDMTVGGKSAGRIVMELYADTTPETAENFRALCTGERGIGKQGKPLHYKGSSFHRVIP 66

  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            .|:.|.||....:|:.||||||..|.||||...|...|::||||.| .|:|.|||||.......|
plant    67 KFMCQGGDFTAGNGTGGESIYGSKFKDENFIKKHTGPGILSMANAG-ANTNGSQFFICTEKTSWL 130

  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIA 184
            :|.:||.|:|:.||.:|.::|:..:|.|..:.|:||.|||:|:
plant   131 DGKHVVFGQVVEGLNVVRDIEKVGSDSGRTSKPVVIADCGQIS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 83/165 (50%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
ROC3NP_001318231.1 cyclophilin_ABH_like 5..170 CDD:238907 83/165 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.