DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Cwc27

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001347023.1 Gene:Cwc27 / 67285 MGIID:1914535 Length:472 Species:Mus musculus


Alignment Length:408 Identity:109/408 - (26%)
Similarity:159/408 - (38%) Gaps:98/408 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            ||..|.|     |..||.:.|||.....||...||..||.          ..:|..|.||::...
Mouse    11 TNGKVLL-----KTTAGDIDIELWSKEAPKACRNFIQLCL----------EAYYDNTIFHRVVPG 60

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            |:||.||.. ..|:.||||||..|.|| :..|..|..|:|:|||.| |:.|.||||.:....:.|
Mouse    61 FIVQGGDPT-GTGTGGESIYGAPFKDEFHSRLRFNRRGLVAMANAG-PHDNGSQFFFTLGRADEL 123

  Fly   142 NGTNVVVGRVLRG--LGIVAEMEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAY 204
            |..:.:.|:|...  ..::...|.:..||..|..|..|:.| |:..|.      .|:.|      
Mouse   124 NNKHTIFGKVTGDTVYNMLRLTEVDIDDEERPRNPHRIKSC-EVLFNP------FDDIT------ 175

  Fly   205 PQDWPRKLDKFTGDGAVELLTGIRQSG-NHFYQLGRYHEARAKYRKANRYYHYLSRQFGWQQLNP 268
                ||::.|...:...|.:..::..| .:|..|....||..:..:.||..         |.:..
Mouse   176 ----PREIKKPKNEKPEEEVKKLKPKGTKNFSLLSFGEEAEEEEEEVNRVS---------QSMKG 227

  Fly   269 LKKHLVDEDLLKVD-GFSVVNNINAAAVD--------LKVGNYTSAREVCNEAIRLDPKCSKAFY 324
            ..|.  ..||||.| ..|.|..:.:...|        |:.|...||..  :|.:..|   .|...
Mouse   228 RSKS--SHDLLKDDPHLSSVPAVESEKDDATGDLEDLLQDGEDDSAER--DEYMEDD---EKNLM 285

  Fly   325 RRAQAQRGLRNYEEAINDLKTA-----------HNLLPENKQILNELNSTKQ------------- 365
            |...|:| |:  ::|...:|:|           ..|..|.:|:..||.:.||             
Mouse   286 RERIAKR-LK--KDASASVKSAGDGEKKPASRSEELRKEARQLKRELLAAKQKKETAIKVEEGRE 347

  Fly   366 --------LLAQYNRQQR 375
                    .:|:|.|:::
Mouse   348 EEEAAPDGAVAEYRREKQ 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 57/168 (34%)
TPR repeat 285..315 CDD:276809 8/37 (22%)
TPR_19 300..369 CDD:291240 20/100 (20%)
TPR_1 320..353 CDD:278916 9/43 (21%)
TPR repeat 320..346 CDD:276809 7/25 (28%)
Cwc27NP_001347023.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 65/200 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 431..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.