DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and PPIAL4C

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001129261.2 Gene:PPIAL4C / 653598 HGNCID:33995 Length:164 Species:Homo sapiens


Alignment Length:169 Identity:74/169 - (43%)
Similarity:98/169 - (57%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVF 78
            |.:|:.||::..:..||:.|:|..|.:||||||||||.|||       |...|||:.||:|...|
Human     3 NSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGE-------KGFRYKGSCFHRIIPGF 60

  Fly    79 VVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            :.|.||..:.:|:..:||||..|||||....|...|::||||.| ||:|.|||||..|..|.|:|
Human    61 MCQGGDFTRPNGTGDKSIYGEKFDDENLIRKHTGSGILSMANAG-PNTNGSQFFICTAKTEWLDG 124

  Fly   144 TNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGE 182
            .:|..|:|...:.||..||.........:..|.|.|||:
Human   125 KHVAFGKVKERVNIVEAMEHFGYRNSKTSKKITIADCGQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 71/165 (43%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
PPIAL4CNP_001129261.2 cyclophilin 4..162 CDD:469651 71/165 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.