DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppib

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_071981.1 Gene:Ppib / 64367 RGDID:620312 Length:208 Species:Rattus norvegicus


Alignment Length:176 Identity:79/176 - (44%)
Similarity:106/176 - (60%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81
            ||.|..||.|..||:...|....||||.:||.||.|||.|.|       ||.:|||::.:.|::|
  Rat    38 VYFDFQIGDEPVGRVTFGLFGKTVPKTVDNFVALATGEKGFG-------YKNSKFHRVIKDFMIQ 95

  Fly    82 SGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNV 146
            .||..:.||:.|:||||..|.||||:|.|...|.|||||.|| ::|.|||||:......|:|.:|
  Rat    96 GGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGK-DTNGSQFFITTVKTSWLDGKHV 159

  Fly   147 VVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGI 191
            |.|:||.|:.:|.::|...||..| |...::|.|||:|...:.:.|
  Rat   160 VFGKVLEGMDVVRKVENTKTDSRDKPLKDVIIVDCGKIEVEKPFAI 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 75/164 (46%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PpibNP_071981.1 cyclophilin_ABH_like 37..195 CDD:238907 75/164 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339739
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.