DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppie

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_062362.1 Gene:Ppie / 56031 MGIID:1917118 Length:301 Species:Mus musculus


Alignment Length:170 Identity:81/170 - (47%)
Similarity:110/170 - (64%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            :||.||:||.||.:.|||:.:.||.||||.||||||.|||.|.|.|       :||:.||:|...
Mouse   138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-------FKGSSFHRIIPQ 195

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLN 142
            |:.|.||...::|:.|:||||..||||||.|.|...|::||||.| ||:|.||||::....:.|:
Mouse   196 FMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG-PNTNGSQFFLTCDKTDWLD 259

  Fly   143 GTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGE 182
            |.:||.|.|..||.::.::|...:.:|.|...::|.||||
Mouse   260 GKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVMIADCGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 77/165 (47%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PpieNP_062362.1 RRM <5..194 CDD:223796 34/62 (55%)
RRM_PPIE 8..80 CDD:240793
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..141 1/2 (50%)
cyclophilin_ABH_like 140..298 CDD:238907 77/165 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836079
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.