DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and ppil1

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:157 Identity:59/157 - (37%)
Similarity:88/157 - (56%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFV 79
            |.|.||.::     |.:::||..:..|||.:||          ..||:..:|..||||:|.:.|:
Zfish    12 PTVSLDTTM-----GTIVLELYWNHAPKTCKNF----------AELGRRGYYNSTKFHRIIKDFM 61

  Fly    80 VQSGDVVKNDGSSGESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            ||.||.. ..|..|.||||..|:|| :.||.....|:::|||.| |::|.||||:|.|..:.|:|
Zfish    62 VQGGDPT-GTGRGGASIYGKQFEDEFHPELKFTGAGILAMANAG-PDTNGSQFFLSLAPTQWLDG 124

  Fly   144 TNVVVGRVLRGLGI---VAEMEQNCTD 167
            .:.:.|||.:|:|:   :..:|.|..|
Zfish   125 KHTIFGRVCQGIGVLNRIGMVETNSQD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 59/157 (38%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 57/153 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.