DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and ppil4

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001121802.1 Gene:ppil4 / 554886 ZFINID:ZDB-GENE-030131-6251 Length:454 Species:Danio rerio


Alignment Length:340 Identity:78/340 - (22%)
Similarity:134/340 - (39%) Gaps:92/340 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSG 93
            |.::|:|..:..||.:.||..||          |..:|.....|.::|.|::|:||.. ..|..|
Zfish    10 GDIVIDLYTEERPKASLNFLKLC----------KIKYYNYCLIHNVQRDFIIQTGDPT-GTGRGG 63

  Fly    94 ESIYGPVFDDEN--FE------LSHNEEGVVSMANYGKPNSNNSQFFISAAGCEN---LNGTNVV 147
            ||::..::.|:.  ||      :.|.::|.|||.|.|. :.:.|||.|:..  ||   |:|.:.|
Zfish    64 ESVFCKLYGDQARFFESEKMPRIKHRKKGTVSMVNNGS-DQHGSQFLITTG--ENVDYLDGVHTV 125

  Fly   148 VGRVLRGLGIVAEMEQNCTDE--------------------GDPTA-PIVIR---------DCGE 182
            .|.|..|:.::|::.:...|.                    .||.. |:..|         |.|.
Zfish   126 FGEVTEGMDVLAKINETFVDNDFIPFQDIRINHTVILDDPFDDPAGLPVPDRSPEPTKQQLDSGR 190

  Fly   183 IAHNEDWGIECNDETTDKLPAYPQDWPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKY 247
            |..:|...   :||..|         |.:||:...|...:....:.:      .:|...:|..|.
Zfish   191 IGADEAIN---DDEGKD---------PEELDELIKDKEAKTQAILLE------MVGDLPDADIKP 237

  Fly   248 RKANRYYHYLSRQFGWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVGNYTSAREVCNEA 312
            .:...:.         .:|||:   ..||||..:  ||....|....:   :.::.:...:|...
Zfish   238 PENVLFV---------CKLNPV---TTDEDLEII--FSRFGLIKCCEI---IRDWKTGESLCYAF 285

  Fly   313 IRLDPK--CSKAFYR 325
            |..:.:  |.||:::
Zfish   286 IEFEKEEDCEKAYFK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 50/192 (26%)
TPR repeat 285..315 CDD:276809 4/29 (14%)
TPR_19 300..369 CDD:291240 5/28 (18%)
TPR_1 320..353 CDD:278916 2/6 (33%)
TPR repeat 320..346 CDD:276809 2/6 (33%)
ppil4NP_001121802.1 cyclophilin_RRM 4..169 CDD:238902 45/172 (26%)
RRM 172..>320 CDD:223796 31/164 (19%)
RRM_PPIL4 237..319 CDD:240681 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.