DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and PPIC

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_000934.1 Gene:PPIC / 5480 HGNCID:9256 Length:212 Species:Homo sapiens


Alignment Length:185 Identity:81/185 - (43%)
Similarity:109/185 - (58%) Gaps:9/185 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76
            |....|:.|:.||.:|.||::|.|...|||||.|||.||.|||.|.|       |||:|||::.:
Human    35 SVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYG-------YKGSKFHRVIK 92

  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            .|::|.||:...||:.|.||||..|.||||:|.|...|.|||||.| |::|.|||||:......|
Human    93 DFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAG-PDTNGSQFFITLTKPTWL 156

  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECND 195
            :|.:||.|:|:.|:.:|..:|...||..| |.....|.:.|:|.....:.:|..|
Human   157 DGKHVVFGKVIDGMTVVHSIELQATDGHDRPLTNCSIINSGKIDVKTPFVVEIAD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 76/166 (46%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PPICNP_000934.1 cyclophilin 39..197 CDD:294131 76/165 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145996
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.