DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and PPIL1

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:157 Identity:58/157 - (36%)
Similarity:88/157 - (56%) Gaps:21/157 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFV 79
            |.|||:.|:     |.:::||.....|||.:||          ..|.:..:|.|||||:|.:.|:
Human    12 PNVYLETSM-----GIIVLELYWKHAPKTCKNF----------AELARRGYYNGTKFHRIIKDFM 61

  Fly    80 VQSGDVVKNDGSSGESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            :|.||.. ..|..|.||||..|:|| :.:|.....|:::|||.| |::|.||||::.|..:.|:|
Human    62 IQGGDPT-GTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAG-PDTNGSQFFVTLAPTQWLDG 124

  Fly   144 TNVVVGRVLRGLGI---VAEMEQNCTD 167
            .:.:.|||.:|:|:   |..:|.|..|
Human   125 KHTIFGRVCQGIGMVNRVGMVETNSQD 151

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 58/157 (37%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 56/154 (36%)
Cyclosporin A binding. /evidence=ECO:0000305|PubMed:16595688 54..65 4/10 (40%)