DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and Cypl

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_001238262.1 Gene:Cypl / 4577663 VectorBaseID:AGAMI1_012731 Length:175 Species:Anopheles gambiae


Alignment Length:151 Identity:58/151 - (38%)
Similarity:81/151 - (53%) Gaps:14/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSG 93
            |.:.|||.....|.|..||          ..|.:..:|.||:||:|.|.|:||.||.. ..|..|
Mosquito    29 GELTIELYWKHAPNTCRNF----------AELARRGYYNGTQFHRIIRDFMVQGGDPT-GTGRGG 82

  Fly    94 ESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGI 157
            :||||..|.|| :.:|.|...|:|||||.| |::|.|||||:....:.|:|.:.:.||:..|:.:
Mosquito    83 QSIYGATFADEIHSDLKHTGAGIVSMANSG-PDTNGSQFFITLGPTQWLDGKHTIFGRIHTGMQV 146

  Fly   158 VAEMEQNCTDEGD-PTAPIVI 177
            |..:....||:.| |..|:.|
Mosquito   147 VKRIGLVETDKNDRPVEPVKI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 58/151 (38%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
CyplXP_001238262.1 cyclophilin 25..169 CDD:469651 58/151 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.