DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Moca-cyp

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_733246.1 Gene:Moca-cyp / 43374 FlyBaseID:FBgn0039581 Length:970 Species:Drosophila melanogaster


Alignment Length:178 Identity:82/178 - (46%)
Similarity:112/178 - (62%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTL-GKPLHYKGTKF 71
            |...:|.|..:.|||:|....||::.||..||.||||||||||||||.|.|.: ||.|.|||..|
  Fly     6 RDAGATRPRCFFDISLGGLGMGRIVFELFNDVAPKTAENFRALCTGEKGFGLITGKKLQYKGVIF 70

  Fly    72 HKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAA 136
            |::.:.|:||:||....:|:.||||||..|:||:||..|:...::||||.|| |:|.|||||:..
  Fly    71 HRVVKDFMVQAGDFSAGNGTGGESIYGGTFEDESFEKKHDRPFLLSMANRGK-NTNGSQFFITTQ 134

  Fly   137 GCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI 183
            ...:|:..:||.|:|:.|..:|.::|....|... |.....|.:|||:
  Fly   135 PAPHLDNIHVVFGQVISGQELVRQLEGLPVDRNSRPLQDAAIANCGEL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 77/167 (46%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Moca-cypNP_733246.1 cyclophilin 13..180 CDD:294131 77/167 (46%)
SH3-RhoG_link 635..>718 CDD:293215
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447202
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.