DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and cwc27

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_957397.1 Gene:cwc27 / 394078 ZFINID:ZDB-GENE-040426-1118 Length:470 Species:Danio rerio


Alignment Length:403 Identity:103/403 - (25%)
Similarity:154/403 - (38%) Gaps:121/403 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            ||..|.|     |..||.:.|||.....||...||..||...          :|.||.||::...
Zfish    11 TNGKVLL-----KTSAGDIDIELWSKETPKACRNFVQLCMEG----------YYDGTIFHRMVPE 60

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            |:||.||.. ..|:.||||||..|.|| :..|..|..|:|:|||.| |:.|.||||.:....:.|
Zfish    61 FIVQGGDPT-GTGTGGESIYGRPFKDEFHSRLRFNRRGLVAMANAG-PHDNGSQFFFTLGRADEL 123

  Fly   142 NGTNVVVGRV--------LRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETT 198
            |..:.:.|:|        || |..||     |..:..|..|..||.. |:.|:            
Zfish   124 NNKHTIFGKVTGDTVYNMLR-LADVA-----CDGDERPLNPHKIRST-EVLHS------------ 169

  Fly   199 DKLPAYPQD--WPRKLDKFTGDGAVELLTGIRQSGNHFYQLGRYHEARAKYRKANRYYHYLSRQF 261
                  |.|  .||:            :.|.::...        .||:....||.:.:..||  |
Zfish   170 ------PFDDIIPRE------------IKGKKEKNK--------DEAKKSQSKATKNFSLLS--F 206

  Fly   262 GWQQLNPLKKHLVDEDLLKVDGFSVVNNINAAAVDLKVGNYTSAREVCNEAIRLDPKCSKAFYRR 326
            |       ::...||::           :|..:..:| |...|:.::..:    |||.|..  ..
Zfish   207 G-------EEAEEDEEM-----------VNQVSQTMK-GKSKSSHDLLKD----DPKLSSV--PV 246

  Fly   327 AQAQRGLRNYEEAIND--------------LKTAHNLLPE-NKQILNELNSTKQLLAQYNR---- 372
            ....:|..::|::.:|              .|...|:..: .|...:|..|::.|:.:.:|    
Zfish   247 VDRNQGEGDFEDSDDDEDDAEDDSDREAEKAKVRENIAKKLKKDKTDEEKSSQDLVKKTSRSDEL 311

  Fly   373 --QQRNALKNLFA 383
              :.|...|.|.|
Zfish   312 RKEARQLKKELLA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 62/174 (36%)
TPR repeat 285..315 CDD:276809 4/29 (14%)
TPR_19 300..369 CDD:291240 15/83 (18%)
TPR_1 320..353 CDD:278916 6/47 (13%)
TPR repeat 320..346 CDD:276809 5/39 (13%)
cwc27NP_957397.1 cyclophilin_CeCYP16-like 8..178 CDD:238906 69/208 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..377 36/200 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.