DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and cyp33

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:178 Identity:84/178 - (47%)
Similarity:110/178 - (61%) Gaps:8/178 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70
            ::...:..||.|:.||.||..||||:::.||.|||||||||||.|||.|.|.|       |||..
  Fly   130 VIEKAEKRNPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQGYG-------YKGCS 187

  Fly    71 FHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISA 135
            ||::...|:.|.||...|:|:.|:||||..|:||||.|.||..|.:||||.| .|:|.|||||..
  Fly   188 FHRVIPEFMCQGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSG-ANTNGSQFFICT 251

  Fly   136 AGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEI 183
            ...:.|:..:||.|.|:.|..:|.:||:..:..|.|:..|||..|||:
  Fly   252 TKTDWLDNKHVVFGHVISGAEVVRKMERCGSKSGTPSQKIVIYSCGEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 80/165 (48%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
cyp33NP_523773.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 139..297 CDD:238907 80/165 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.