DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and CG11777

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster


Alignment Length:189 Identity:64/189 - (33%)
Similarity:88/189 - (46%) Gaps:50/189 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGS 91
            |.|.:.|||..|..||..|||.|||..:          :|.|..|.:..:.|:||:||.. |.|.
  Fly     8 DVGDLKIELFCDACPKACENFLALCASD----------YYSGCVFIRNIKGFIVQTGDPT-NTGK 61

  Fly    92 SGESIYGPVFDDENFE-LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGL 155
            :|:||:|..||||..| :.|.:.|:|||||.| ||:|.|||||:.|...||:....:.|||:.|.
  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNG-PNANASQFFITYAAQPNLDLKYTLFGRVIDGF 125

  Fly   156 GIVAEMEQNCTDEGDPTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAYPQDWPRKLDK 214
            ..:.|:|                                     |||..|:::...:||
  Fly   126 DALDELE-------------------------------------KLPVNPKNYRPHVDK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 58/154 (38%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/189 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.