DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and CG17266

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_610224.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster


Alignment Length:173 Identity:83/173 - (47%)
Similarity:111/173 - (64%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76
            |.||:|:.||::|..:.||||.||..|.||:||||||..||||  ....|.|:.|||..||::.:
  Fly    14 SNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIK 76

  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            .|::|.||.|:.||:...||||..|.||||.|.|:..|::||||.|| .:|..||||:.|.|..|
  Fly    77 DFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGK-ETNGCQFFITCAKCNFL 140

  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI 183
            :|.:||.||||.||.|:.::|...|...: |..|:.|..||::
  Fly   141 DGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 79/166 (48%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
CG17266NP_610224.1 cyclophilin_ABH_like 17..181 CDD:238907 79/166 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.