Sequence 1: | NP_001261636.1 | Gene: | CG8336 / 39121 | FlyBaseID: | FBgn0036020 | Length: | 383 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001338072.4 | Gene: | nktr / 323005 | ZFINID: | ZDB-GENE-030131-1725 | Length: | 1396 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 79/197 - (40%) |
---|---|---|---|
Similarity: | 115/197 - (58%) | Gaps: | 10/197 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHKIKRVF 78
Fly 79 VVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
Fly 144 TNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDETTDKL--PAYP 205
Fly 206 QD 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8336 | NP_001261636.1 | cyclophilin | 15..181 | CDD:294131 | 71/167 (43%) |
TPR repeat | 285..315 | CDD:276809 | |||
TPR_19 | 300..369 | CDD:291240 | |||
TPR_1 | 320..353 | CDD:278916 | |||
TPR repeat | 320..346 | CDD:276809 | |||
nktr | XP_001338072.4 | cyclophilin | 7..174 | CDD:294131 | 71/167 (43%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170579525 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1403619at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000032 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.750 |