DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and CG15767

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_572264.1 Gene:CG15767 / 31508 FlyBaseID:FBgn0029809 Length:370 Species:Drosophila melanogaster


Alignment Length:206 Identity:46/206 - (22%)
Similarity:75/206 - (36%) Gaps:62/206 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EERKLLRAVKSTNPLVYLDISI--GKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPL 64
            |..:|||      |.:.|...:  |: ..|:::::|..:..|.....|...|.|:          
  Fly   197 ELMRLLR------PRIVLHFGLMDGR-PLGQVVVQLYTEAAPLVVLQFVRTCLGQ---------- 244

  Fly    65 HYKGTKFHK--IKRVFV---VQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKP 124
                 :.|:  ::|:|.   |:...:.....|.||:......|...|:..     |||.|.|.  
  Fly   245 -----RSHEFAVRRIFPRLWVEGYLLSSCKNSLGEASSLSYRDPMEFDTR-----VVSHARYA-- 297

  Fly   125 NSNNSQFFISAA----------GCENLN----------GTNVVVGRVLRGLGIVAEMEQNCTDEG 169
                  |.:|.|          |..|.:          |..|..|||:||..::..||.:.|..|
  Fly   298 ------FVLSCAKEYCVHGFPGGAINFSISFKPLPVARGQRVGFGRVIRGDKVIEAMEAHGTKNG 356

  Fly   170 DPTAPIVIRDC 180
            ..:.|::|..|
  Fly   357 KISRPLLITHC 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 42/193 (22%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
CG15767NP_572264.1 cyclophilin 203..370 CDD:294131 43/200 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.