DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and Ppil3

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:156 Identity:62/156 - (39%)
Similarity:84/156 - (53%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGS 91
            |.|.:.||:..:..|||.|||.|||...          :|.|..||:..:.|:||:||.. ..|.
  Rat     8 DVGDIKIEVFCERTPKTCENFLALCASN----------YYNGCVFHRNIKGFMVQTGDPT-GTGR 61

  Fly    92 SGESIYGPVFDDENFE-LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGL 155
            .|.||:|..|:||..| |.||..|||||||.| ||:|.|||||:.....:|:....|.|:|:.||
  Rat    62 GGSSIWGKKFEDEYSEYLKHNVRGVVSMANNG-PNTNGSQFFITYGKQPHLDMKYTVFGKVIDGL 125

  Fly   156 GIVAEMEQNCTDEGD--PTAPIVIRD 179
            ..:.|:|:...:|..  |...:.|:|
  Rat   126 ETLDELEKLPVNEKTYRPLNDVHIKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 62/156 (40%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 62/156 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.