DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppil3

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:156 Identity:62/156 - (39%)
Similarity:84/156 - (53%) Gaps:15/156 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGS 91
            |.|.:.||:..:..|||.|||.|||...          :|.|..||:..:.|:||:||.. ..|.
  Rat     8 DVGDIKIEVFCERTPKTCENFLALCASN----------YYNGCVFHRNIKGFMVQTGDPT-GTGR 61

  Fly    92 SGESIYGPVFDDENFE-LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGL 155
            .|.||:|..|:||..| |.||..|||||||.| ||:|.|||||:.....:|:....|.|:|:.||
  Rat    62 GGSSIWGKKFEDEYSEYLKHNVRGVVSMANNG-PNTNGSQFFITYGKQPHLDMKYTVFGKVIDGL 125

  Fly   156 GIVAEMEQNCTDEGD--PTAPIVIRD 179
            ..:.|:|:...:|..  |...:.|:|
  Rat   126 ETLDELEKLPVNEKTYRPLNDVHIKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 62/156 (40%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 62/156 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.