DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and Ppie

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:170 Identity:80/170 - (47%)
Similarity:110/170 - (64%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            :||.||:||.||.:.|||:.:.||.||||.||||||.|||.|.|.|       :||:.||:|...
  Rat   138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-------FKGSSFHRIIPQ 195

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLN 142
            |:.|.||...::|:.|:||||..||||||.|.|...|::||||.| ||:|.||||::....:.|:
  Rat   196 FMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG-PNTNGSQFFLTCDKTDWLD 259

  Fly   143 GTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGE 182
            |.:||.|.:..||.::.::|...:.:|.|...::|.||||
  Rat   260 GKHVVFGEITDGLDVLRQIEAQGSKDGKPKQKVIIADCGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 76/165 (46%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 76/165 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.