DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppic

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001004215.1 Gene:Ppic / 291463 RGDID:1303221 Length:212 Species:Rattus norvegicus


Alignment Length:191 Identity:81/191 - (42%)
Similarity:110/191 - (57%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKSTNPL----VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTK 70
            |:...||    |:.|:.||.:|.||::|.|...|||:|.|||..|.|||.|.|       |||:.
  Rat    29 VRKRGPLVTDKVFFDVRIGDKDVGRIVIGLFGKVVPRTVENFVTLATGEKGYG-------YKGSI 86

  Fly    71 FHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISA 135
            ||::.:.|::|.||....||:.|.||||..|.||||:|.|...|.|||||.| |::|.|||||:.
  Rat    87 FHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDENFKLKHYGIGWVSMANAG-PDTNGSQFFITL 150

  Fly   136 AGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECND 195
            .....|:|.:||.|:||.|:.:|..:|...||:.| |.....|.:.|:|.....:.:|..|
  Rat   151 TKPAWLDGKHVVFGKVLDGMTVVHSIELQATDDHDRPLTDCTIVNSGKIDVKTPFVVEVPD 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 76/170 (45%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PpicNP_001004215.1 cyclophilin_ABH_like 38..197 CDD:238907 74/166 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339737
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.