DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and cyp1

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_593308.1 Gene:cyp1 / 2543019 PomBaseID:SPAC57A10.03 Length:155 Species:Schizosaccharomyces pombe


Alignment Length:163 Identity:66/163 - (40%)
Similarity:88/163 - (53%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81
            |.|..|:||     ::|||..:..|||.:||.          ||.|..:|.|..||::...||:|
pombe     4 VELQTSLGK-----ILIELYTEHAPKTCQNFY----------TLAKEGYYDGVIFHRVIPDFVIQ 53

  Fly    82 SGDVVKNDGSSGESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTN 145
            .||.. ..|..|.||||..|||| :.:|.|...|::||||.| ||:|:|||||:.|....|:|.:
pombe    54 GGDPT-GTGRGGTSIYGDKFDDEIHSDLHHTGAGILSMANAG-PNTNSSQFFITLAPTPWLDGKH 116

  Fly   146 VVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVI 177
            .:.|||:.||.:...|....||..| |..|:.|
pombe   117 TIFGRVVSGLSVCKRMGLIRTDSSDRPIEPLKI 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 66/163 (40%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
cyp1NP_593308.1 cyclophilin 6..151 CDD:469651 65/161 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.