DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and cyp4

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_596532.1 Gene:cyp4 / 2541395 PomBaseID:SPBP8B7.25 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:195 Identity:86/195 - (44%)
Similarity:114/195 - (58%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RAVKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFH 72
            |..|.|: .||.|:..|.|..||:.|.|....|||||||||||.|||.|.|       |:|:.||
pombe    21 RGPKVTD-TVYFDLQQGDEFLGRVTIGLFGKTVPKTAENFRALATGEKGFG-------YEGSIFH 77

  Fly    73 KIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAG 137
            ::...|::|.||:.|.||:.|:||||..|.||||:|||...|::||||.| |:||.|||||:...
pombe    78 RVIPNFMIQGGDITKGDGTGGKSIYGSRFPDENFKLSHQRPGLLSMANAG-PDSNGSQFFITTVK 141

  Fly   138 CENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDETTDKL 201
            ...|:|.:||.|.||.|..||.::.:..||..| |...:.|...|:::..     ...|:.||:|
pombe   142 TPWLDGHHVVFGEVLSGYDIVKKISKAETDNRDKPLEDVKIIKSGQLSQE-----NVEDDGTDEL 201

  Fly   202  201
            pombe   202  201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 78/166 (47%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
cyp4NP_596532.1 cyclophilin 27..186 CDD:294131 78/167 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.