Sequence 1: | NP_001261636.1 | Gene: | CG8336 / 39121 | FlyBaseID: | FBgn0036020 | Length: | 383 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_729026.1 | Gene: | CG32236 / 249170 | FlyBaseID: | FBgn0046793 | Length: | 385 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 39/200 - (19%) |
---|---|---|---|
Similarity: | 70/200 - (35%) | Gaps: | 65/200 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 LLRAVKSTNPLVYLDISIGKED--AGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKG 68
Fly 69 TKFHKIKRVF---------VVQSGDVVKNDGSSGESIYGP---------VFDDENFELSHNEEGV 115
Fly 116 VSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNC----TDEGDPTAPIV 176
Fly 177 IRDCG 181 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8336 | NP_001261636.1 | cyclophilin | 15..181 | CDD:294131 | 34/189 (18%) |
TPR repeat | 285..315 | CDD:276809 | |||
TPR_19 | 300..369 | CDD:291240 | |||
TPR_1 | 320..353 | CDD:278916 | |||
TPR repeat | 320..346 | CDD:276809 | |||
CG32236 | NP_729026.1 | KIAA1430 | 85..177 | CDD:290590 | |
cyclophilin | 227..385 | CDD:294131 | 36/197 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |