DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and PPIL2

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:144 Identity:61/144 - (42%)
Similarity:78/144 - (54%) Gaps:16/144 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSG 93
            |.:.:||..|:.|||.|||..||          |..:|.||.||:..|.||:|.||.. ..|:.|
Human   289 GDLNLELHCDLTPKTCENFIRLC----------KKHYYDGTIFHRSIRNFVIQGGDPT-GTGTGG 342

  Fly    94 ESIYGPVFDDE-NFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNVVVGRVLRGLGI 157
            ||.:|..|.|| ...|||...|::||||.| ||||.|||||:...|..|:..:.:.|||:.|..:
Human   343 ESYWGKPFKDEFRPNLSHTGRGILSMANSG-PNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDV 406

  Fly   158 VAEMEQNCTDEGDP 171
            :..||   ..|.||
Human   407 LTAME---NVESDP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 61/144 (42%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418
U-box domain, a modified RING finger 103..146 CDD:319361
cyclophilin_RING 281..440 CDD:238904 61/144 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.