DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and Ppig

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001074555.1 Gene:Ppig / 228005 MGIID:2445173 Length:752 Species:Mus musculus


Alignment Length:176 Identity:83/176 - (47%)
Similarity:114/176 - (64%) Gaps:3/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIG-TLGKPLHYKGTKFHK 73
            :|...|..:.||:|..:.|||::.||..||.|||.||||.|||||.|.| :..||||||...||:
Mouse     3 IKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHYKSCLFHR 67

  Fly    74 IKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGC 138
            :.:.|:||.||..:.:|..||||||..|:||:|.:.||:|.::||||.|| ::|.|||||:....
Mouse    68 VVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGK-DTNGSQFFITTKPT 131

  Fly   139 ENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI 183
            .:|:|.:||.|:|:.|..:|.|:|...||... |.|.:.|..|||:
Mouse   132 PHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGEL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 79/167 (47%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PpigNP_001074555.1 cyclophilin 8..175 CDD:412213 79/167 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..752
PTZ00121 <401..750 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836081
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.