Sequence 1: | NP_001261636.1 | Gene: | CG8336 / 39121 | FlyBaseID: | FBgn0036020 | Length: | 383 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501118.1 | Gene: | cyn-12 / 191627 | WormBaseID: | WBGene00000888 | Length: | 169 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 69/195 - (35%) |
---|---|---|---|
Similarity: | 94/195 - (48%) | Gaps: | 42/195 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 PLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFV 79
Fly 80 VQSGDVVKNDGSSGESIYGPVFDDENFE-LSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
Fly 144 TNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDETTDKLPAYPQD 207
Fly 208 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8336 | NP_001261636.1 | cyclophilin | 15..181 | CDD:294131 | 65/167 (39%) |
TPR repeat | 285..315 | CDD:276809 | |||
TPR_19 | 300..369 | CDD:291240 | |||
TPR_1 | 320..353 | CDD:278916 | |||
TPR repeat | 320..346 | CDD:276809 | |||
cyn-12 | NP_501118.1 | cyclophilin_SpCYP2_like | 13..159 | CDD:238903 | 63/185 (34%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000032 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |