DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and cyn-1

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_506561.1 Gene:cyn-1 / 179936 WormBaseID:WBGene00000877 Length:192 Species:Caenorhabditis elegans


Alignment Length:187 Identity:93/187 - (49%)
Similarity:122/187 - (65%) Gaps:10/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLRA---------VKSTNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLG 61
            ||||         ..|..|.|:.|:|||:|.|||:.:||..|||||||||||||||||.|:|..|
 Worm     4 LLRASSLAGQSLRFASQRPKVFFDVSIGEEPAGRVTMELFNDVVPKTAENFRALCTGEKGVGEQG 68

  Fly    62 KPLHYKGTKFHKIKRVFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNS 126
            ..||:||:|||:|...|::|.||..:::|:.||||||..|.||||:|.|...|.:||||.| ||:
 Worm    69 VALHFKGSKFHRIIPEFMIQGGDFTRHNGTGGESIYGNKFKDENFDLKHTGPGCLSMANAG-PNT 132

  Fly   127 NNSQFFISAAGCENLNGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEI 183
            |.|||||.......|:|.:||.|:|..|:.:|.::|:..:..|.|...:.|.||||:
 Worm   133 NGSQFFICTVDTPWLDGGHVVFGQVTDGMSVVKKIEKMGSRSGAPAKTVTIADCGEL 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 85/165 (52%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
cyn-1NP_506561.1 cyclophilin_ABH_like 22..187 CDD:238907 85/165 (52%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.