DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and cyn-2

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_499828.1 Gene:cyn-2 / 176807 WormBaseID:WBGene00000878 Length:172 Species:Caenorhabditis elegans


Alignment Length:167 Identity:86/167 - (51%)
Similarity:118/167 - (70%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81
            |:.||:||.:..||:::||..|:|||||||||||||||.|.|..||.||:||:|||:|...|::|
 Worm     6 VFFDITIGGKKGGRIVMELYNDIVPKTAENFRALCTGEKGKGKSGKKLHFKGSKFHRIIPEFMIQ 70

  Fly    82 SGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNV 146
            .||..:.:|:.||||:|..||||||:..|...||:||||.| .|:|.||||:.......|:|.:|
 Worm    71 GGDFTEGNGTGGESIHGEKFDDENFKEKHTGPGVLSMANCG-ANTNGSQFFLCTVKTTWLDGKHV 134

  Fly   147 VVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEI 183
            |.|:|:.|:.:|..:|...:::|.|:||.||.||||:
 Worm   135 VFGKVIEGMDVVKAIESKGSEDGAPSAPCVIADCGEM 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 83/163 (51%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
cyn-2NP_499828.1 cyclophilin_ABH_like 5..169 CDD:238907 83/163 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.