DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and ninaA

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:XP_319131.5 Gene:ninaA / 1279414 VectorBaseID:AGAMI1_012925 Length:253 Species:Anopheles gambiae


Alignment Length:217 Identity:81/217 - (37%)
Similarity:119/217 - (54%) Gaps:26/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVFVVQ 81
            ||:|:||..|..||:.|.:..:..|||..|||.|||.:.      ....|||::||::.:.|::|
Mosquito    32 VYMDVSIDGEKIGRITIGMFGEEAPKTVANFRQLCTKDV------DGFSYKGSRFHRVIQKFMIQ 90

  Fly    82 SGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNGTNV 146
            .||||..||....|:||..|||||.:::|...|.::|||.| ||:|..||:|:......|:|.:.
Mosquito    91 GGDVVSGDGHGAISMYGKYFDDENLKINHTCSGFIAMANRG-PNTNGCQFYITTLPAPWLDGKHT 154

  Fly   147 VVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEIAHNEDWGIECNDETTD--------KLP 202
            :.|:||.|..:|.::||..||..| |..|::|.|||::.....:.:  :|:..|        .||
Mosquito   155 IFGKVLDGQAVVHKVEQVRTDTDDYPVKPVIIEDCGDLPILGPFTV--SDDPYDLWAWIKAAYLP 217

  Fly   203 --------AYPQDWPRKLDKFT 216
                    |:.|...||||.||
Mosquito   218 LGMSFSILAFFQYIIRKLDGFT 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 67/164 (41%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
ninaAXP_319131.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.