DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and PPIH

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_006338.1 Gene:PPIH / 10465 HGNCID:14651 Length:177 Species:Homo sapiens


Alignment Length:171 Identity:81/171 - (47%)
Similarity:115/171 - (67%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRVF 78
            ||:|:.|:|||.::.|||.|||..|||||||||||..||||  ....|.|:.|||:.||::.:.|
Human    10 NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGE--FRKDGVPIGYKGSTFHRVIKDF 72

  Fly    79 VVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLNG 143
            ::|.||.|..||:...|||...|.||||:|.|:..|::||||.| |::|..||||:.:.|:.|:|
Human    73 MIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSG-PSTNGCQFFITCSKCDWLDG 136

  Fly   144 TNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI 183
            .:||.|:::.||.::.::|...|...: |..|:||..|||:
Human   137 KHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 77/166 (46%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
PPIHNP_006338.1 cyclophilin 8..177 CDD:469651 80/169 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.