DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp40 and PPIE

DIOPT Version :10

Sequence 1:NP_648338.1 Gene:Cyp40 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001181936.1 Gene:PPIE / 10450 HGNCID:9258 Length:314 Species:Homo sapiens


Alignment Length:150 Identity:74/150 - (49%)
Similarity:99/150 - (66%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKRV 77
            :||.||:||.||.:.|||:.:.||.||||.||||||.|||.|.|.|       :||:.||:|...
Human   138 SNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFG-------FKGSSFHRIIPQ 195

  Fly    78 FVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENLN 142
            |:.|.||...::|:.|:||||..||||||.|.|...|::||||.| ||:|.||||::....:.|:
Human   196 FMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG-PNTNGSQFFLTCDKTDWLD 259

  Fly   143 GTNVVVGRVLRGLGIVAEME 162
            |.:||.|.|..||.::.::|
Human   260 GKHVVFGEVTEGLDVLRQIE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp40NP_648338.1 cyclophilin 15..181 CDD:469651 72/147 (49%)
TPR 231..>370 CDD:440225
TPR repeat 285..315 CDD:276809
TPR repeat 320..346 CDD:276809
PPIENP_001181936.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..279 CDD:238907 72/146 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.