DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8336 and PPIF

DIOPT Version :9

Sequence 1:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_005720.1 Gene:PPIF / 10105 HGNCID:9259 Length:207 Species:Homo sapiens


Alignment Length:173 Identity:84/173 - (48%)
Similarity:113/173 - (65%) Gaps:8/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76
            |.|||||||:....:..||:::||:.|||||||||||||||||.|.|       |||:.||::..
Human    43 SGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFG-------YKGSTFHRVIP 100

  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141
            .|:.|:||...::|:.|:||||..|.||||.|.|...||:||||.| ||:|.|||||.....:.|
Human   101 SFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAG-PNTNGSQFFICTIKTDWL 164

  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGDPTAPIVIRDCGEIA 184
            :|.:||.|.|..|:.:|.::|...:..|..:..|||.|||:::
Human   165 DGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 80/165 (48%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
PPIFNP_005720.1 cyclophilin_ABH_like 46..204 CDD:238907 80/165 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.